PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_006910_rqak.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 157aa    MW: 18101.2 Da    PI: 5.775
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_006910_rqak.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-11462563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+++NRe+ArrsR RK++ ++ L   +++L  eN +  ++ +  ++++ ++++e+
  Bv1_006910_rqak.t1  4 RKRKRMASNRESARRSRMRKQKHLDDLMAQADQLRRENNQILQTTNVTTQQYVNVEAEN 62
                        5789***********************************99999988888887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507265IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-8379No hitNo description
PfamPF001701.8E-8455IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-11457No hitNo description
CDDcd147026.12E-19555No hitNo description
PROSITE patternPS000360722IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MDERKRKRMA SNRESARRSR MRKQKHLDDL MAQADQLRRE NNQILQTTNV TTQQYVNVEA  60
ENSVLKAQMN ELSQRLQSLN DILNYMNTLN GINSFVEVEE ESLDILGHDM GDFGIMNGGY  120
FGNFTQNNNN INNVIGNPWN LGFLNQPIMA SSNVLQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324RKRKRMASNRESARRSRMRKQK
21623RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672920.11e-112PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0J8FYL21e-112A0A0J8FYL2_BETVU; Uncharacterized protein
STRINGPOPTR_0005s25290.15e-49(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.16e-31basic leucine-zipper 44